I am considering hosting a group buy / group test for longevity peptides. Please let me know if you might be interested in participating. Typical structure is payments would be individually to the vendor in crypto. Prices discounted depending on participation, but maybe $350 for 100 mg FOX04-DRI (enough for one cycle), and maybe $150 for 100 - 200 mg of the other peptides. Testing expenses would be shared, typically $350 / vial tested, and we would send a few vials to the 3rd party tester after we receive from the vendor. I’m just volunteering to manage it, I don’t get anything except a chance to participate in the discount. No promises, but if we get enough interest I will likely do it.
You may want to limit it to people in a specific country (e.g. USA if you’re here), because of issues with potential customs / border seizures).
2 Likes
For a group buy I can supply FOX04-DRI CAS: 2460055-10-9 >98% for $2.00 USD per mg in lots of 500mg (100mg vials x5) = $1,000 - with a MOQ of 3,000mg (6 lots) = $6,000 USD.
No testing on my part. I know my supplier and have been doing business with the same company for over 5 years.
Anyone who wants to test can buy the product and get it tested. caveat emptor
Can ship internationally.
Canonical FOXO4‑DRI (what you’re quoting)
only one canonical FOXO4‑DRI sequence is widely accepted under CAS 2460055‑10‑9
- The research‑standard FOXO4‑DRI is the D‑retro‑inverso peptide with sequence: H‑ltlrkepaseiaqsileaysqngwanrrsggkrppprrrqrrkkrg‑OH in all‑D configuration, MW ≈ 5358 Da.
- This is the peptide used in the original Baar et al. Cell 2017 work and most follow‑on senolytic papers.
$350 for 10 vials of 10mg is standard retail with MOQ of 100mg.
1 cycle is a pretty small group LoL!
I’m offering a real group buy discount for 30 cycles/vials, that would be 15 people doing 2 cycles per year. Still a small group.
You get a real group together and I’ll have the FOX04-DRI ready to ship for 42% less than buying 100gm at a time.